PHASE TRANSITION BIOPOLYMERS AND METHODS OF USE

USPTO Patent Application US 2018/0037609 A1
Application Date: Feb. 8th, 2018

ABSTRACT

The present disclosure describes environmentally responsive polypeptides capable of displaying stimuli-triggered conformational changes in a reversible or irreversible manner that may be accompanied by aggregation. Polypeptides include a number of...
Application Number:
15/679,751
International Classification:
C07K 14/00 (20060101); A61K 38/00 (20060101); A61K 47/42 (20060101); B82Y 5/00 (20060101); C07K 19/00 (20060101); A61K 8/11 (20060101); A61K 8/64 (20060101); A61K 9/51 (20060101); C07K 14/78 (20060101)
No Pictures Available

CLAIMS

We claim:

1. A environmentally responsive polypeptide comprising at least ten sequences selected from VGAPVG, LGAPVG, VPSALYGVG, VGPAVG, VTPAVG, VPSDDYGQG, VPSDDYGVG, TPVAVG, VPSTDYGVG, VPAGVG, VPTGVG, VPAGLG, VPHVG, VHPGVG, VPGAVG, VPGVAG, VRPVG, GRGDSPY, GRGDSPH, GRGDSPV, GRGDSPYG, RPLGYDS, RPAGYDS, RPXGYDS, GRGDSYP, GRGDSPYQ, GRGNSPYG, GRGDAPYQ, VPXSRNGG, VPHSRNGG, VPHSRNGL, VPGHSHRDFQPVLHLVALNSPL SGGMRG, HTHQDFQPVLHLVALNTPLSGGMRGIRPGG, FEWTPGWYQPYG or a combination...

DESCRIPTION

CROSS-REFERENCE TO RELATED APPLICATIONS

This patent application is a divisional of U.S. patent application Ser. No. 14/572,391, filed Dec. 16, 2014, which is a divisional of U.S. patent application Ser. No. 13/904,836, filed May 29, 2013, which is a divisional of U.S. patent application Ser. No. 13/245,459, filed Sep. 26, 2011, which claims priority...
Back to Top